Peptide Information

Go back

Peptide Name: Peptide YY, porcine

Structuire: YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

M.W. 4240.77

Notes: Ref: Tatemoto, K. et al. BBRC 79, 7514 (1982).


For information on large scale synthesis and custom peptide synthesis
visit www.biopeptide.com or call

Phones: 800-909-2494, 858-657-0005

Fax: 858-657-9440


Best listed price found for the specific quantity indicated: $215.00

Vendor: American Peptide Company, Inc.

Phones: 800-926-8272, 408-733-7604

Fax: 408-733-7603


Home Page

 

 

We are not affiliated with the following companies: Advanced ChemTech, Inc., American Peptide Company, Inc., AnaSpec, Inc., BACHEM Bioscience Inc. All copyrights and trademarks are property of their respective owners. Prices are subject to change without notice. Not responisble for mistakes. Even though we try our best to insure the accuracy, information in not guaranteed to be correct.
© 2003, peptide-catalog.com, All Rights Reserved
Privacy Policy