Peptide Information

Go back

Peptide Name: ACTH (7-38), human (CIP)

Structuire: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

M.W. 3659.18


For information on large scale synthesis and custom peptide synthesis
visit www.biopeptide.com or call

Phones: 800-909-2494, 858-657-0005

Fax: 858-657-9440


Best listed price found for the specific quantity indicated: $60.00

Vendor: Advanced ChemTech, Inc.

Phones: 800-456-1403, 502-969-0000

Fax: 502-968-1000


Vendor: AnaSpec, Inc.

Phones: 800-452-5530, 408-452-5055

Fax: 408-452-5059


Home Page

 

We are not affiliated with the following companies: Advanced ChemTech, Inc., American Peptide Company, Inc., AnaSpec, Inc., BACHEM Bioscience Inc. All copyrights and trademarks are property of their respective owners. Prices are subject to change without notice. Not responisble for mistakes. Even though we try our best to insure the accuracy, information in not guaranteed to be correct.
© 2003, peptide-catalog.com, All Rights Reserved