Peptide Name: ACTH (1-39), human
Structuire: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
M.W. 4541.16
Phones: 800-909-2494, 858-657-0005
Fax: 858-657-9440
Phones: 800-926-8272, 408-733-7604
Fax: 408-733-7603
We are not affiliated with
the following companies: Advanced ChemTech, Inc., American Peptide Company, Inc., AnaSpec, Inc., BACHEM Bioscience Inc.
All copyrights and trademarks are property of their respective owners.
Prices are subject to change without notice. Not responisble
for mistakes. Even though we try our best to insure the accuracy, information in not guaranteed to be correct.
© 2003, peptide-catalog.com, All Rights Reserved