Peptide Name: Kaliotoxin
Structuire: (Disulfide bonds between Cys8 and Cys28/Cys14 and Cys33/ Cys18 and Cys35)GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK
M.W. 4150.01
Notes: High conductance Calcium activated K+ channel blocker. Kaliotoxin, originally purified from the venom of the scorpion Androctonus mauretanicus mauretanicus, is a 38amino acid peptide showing 44% sequence homology with charybdotoxin and iberiotoxin. It acts as a specific, voltage-independent inhibitor of high conductance Ca2+ activated K+ channels present in mollusc and rabbit nerve cells.
Phones: 800-909-2494, 858-657-0005
Fax: 858-657-9440
Phones: 888-422-2436, 610-239-0300
Fax: 310-539-9428
We are not affiliated with
the following companies: Advanced ChemTech, Inc., American Peptide Company, Inc., AnaSpec, Inc., BACHEM Bioscience Inc.
All copyrights and trademarks are property of their respective owners.
Prices are subject to change without notice. Not responisble
for mistakes. Even though we try our best to insure the accuracy, information in not guaranteed to be correct.
© 2003, peptide-catalog.com, All Rights Reserved
Privacy Policy