Peptide Information

Go back

Peptide Name: Kaliotoxin

Structuire: (Disulfide bonds between Cys8 and Cys28/Cys14 and Cys33/ Cys18 and Cys35)GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

M.W. 4150.01

Notes: High conductance Calcium activated K+ channel blocker. Kaliotoxin, originally purified from the venom of the scorpion Androctonus mauretanicus mauretanicus, is a 38amino acid peptide showing 44% sequence homology with charybdotoxin and iberiotoxin. It acts as a specific, voltage-independent inhibitor of high conductance Ca2+ activated K+ channels present in mollusc and rabbit nerve cells.

For information on large scale synthesis and custom peptide synthesis
visit www.biopeptide.com or call

Phones: 800-909-2494, 858-657-0005

Fax: 858-657-9440

Best listed price found for the specific quantity indicated: $150.00

Vendor: American Peptide Company, Inc.

Phones: 800-926-8272, 408-733-7604

Fax: 408-733-7603

Home Page

 

 

We are not affiliated with the following companies: Advanced ChemTech, Inc., American Peptide Company, Inc., AnaSpec, Inc., BACHEM Bioscience Inc. All copyrights and trademarks are property of their respective owners. Prices are subject to change without notice. Not responisble for mistakes. Even though we try our best to insure the accuracy, information in not guaranteed to be correct.
© 2003, peptide-catalog.com, All Rights Reserved
Privacy Policy